SKU: 28227217730
Ships within 48 hours · Estimated delivery Sep 6 - Sep 11
kb glutathione price in mercury drug 2018 IJMS | July-2 2026 Contenance:30ml Anti-Glutathione Reductase/GSR Antibody Picoband® snow-caps
Anti-Glutathione Reductase/GSR Antibody Picoband®
Trichomalacia or distortion of the hair follicles is often present in trichotillomania
snow-caps
Contenance:30ml
Product Specifications Product Name: FOXO4-DRI CAS Number: 2460055-10-9 Chemical Formula: C228H388N86O64 Subscript Format: C₂₂₈H₃₈₈N₈₆O₆₄ Molecular Weight: 5358.05 g/mol Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG Peptide Length: 30 amino acids Structure Type: D-amino acid–modified peptide (DRI configuration) What are the key features of FOXO4
US$ 28.68
US$ 23.78
US$ 21.31
