SKU: 49555216415
Ships within 48 hours · Estimated delivery Sep 6 - Sep 11
kb glutathione price in mercury drug 2018 Frontiers Contenance:30ml Anti-Glutathione Reductase/GSR Antibody Picoband® snow-caps
Anti-Glutathione Reductase/GSR Antibody Picoband®
Trichomalacia or distortion of the hair follicles is often present in trichotillomania
snow-caps
Contenance:30ml
Product Specifications Product Name: FOXO4-DRI CAS Number: 2460055-10-9 Chemical Formula: C228H388N86O64 Subscript Format: C₂₂₈H₃₈₈N₈₆O₆₄ Molecular Weight: 5358.05 g/mol Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG Peptide Length: 30 amino acids Structure Type: D-amino acid–modified peptide (DRI configuration) What are the key features of FOXO4
US$ 20.52
US$ 25.98
US$ 28.76
US$ 25.76
US$ 23.08
US$ 29.02
US$ 23.14
US$ 26.51
US$ 23.77
US$ 20.21
US$ 26.63
US$ 22.51
